HPA000798

HSPA2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000798
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000798, RRID:AB_1079090
Product name
Anti-HSPA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000798
Antibody type
Polyclonal
Antigen
Heat shock-related 70 kDa protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMV
QEAERYKSEDEANRDRVAAKNALESYTYNIKQTVE
DEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEK
DEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGS
GASGGPTIEE
Storage
-20C
Provider Type Product Number
- No reagents -