H00083851-B01

SYT16 antibody from Abnova Corporation
CHR14SYT, Strep14, SYT14L, yt14r

Antibody data

Product number
H00083851-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083851-B01, RRID:AB_1138981
Product name
SYT16 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00083851-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SYT16 protein.
Antigen sequence
MTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNI
SSGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVG
LSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKL
FLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVA
LFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSS
GEEEQDHWEEMKETKGQQICRWHTLLES
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -