HPA004199

SYT16 antibody from Sigma-Aldrich
CHR14SYT, Strep14, SYT14L, yt14r
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004199
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004199, RRID:AB_1080156
Product name
Anti-SYT16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004199
Antibody type
Polyclonal
Antigen
Synaptotagmin-16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNIS
SGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGL
SYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLF
LLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVAL
FQLSDVTLM
Storage
-20C
Provider Type Product Number
- No reagents -