Antibody data

Product number
H00006917-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006917-M06, RRID:AB_1137490
Product name
TCEA1 monoclonal antibody (M06), clone 1B7
Provider product page
Abnova Corporation - H00006917-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TCEA1.
Antigen sequence
STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSN
RKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAA
ALRTGDDYIAIGADEEELGSQIEEAIYQEIRNTDM
Isotype
IgG
Antibody clone number
1B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -