Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - ELISA [1]
 - Immunocytochemistry [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00006917-M06 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00006917-M06, RRID:AB_1137490
 - Product name
 - TCEA1 monoclonal antibody (M06), clone 1B7
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant TCEA1.
 - Antigen sequence
 STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSN
RKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAA
ALRTGDDYIAIGADEEELGSQIEEAIYQEIRNTDM- Isotype
 - IgG
 - Antibody clone number
 - 1B7
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western Blot analysis of TCEA1 expression in transfected 293T cell line by TCEA1 monoclonal antibody (M06), clone 1B7.Lane 1: TCEA1 transfected lysate(34 KDa).Lane 2: Non-transfected lysate.
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged TCEA1 is approximately 1ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunofluorescence of monoclonal antibody to TCEA1 on HeLa cell . [antibody concentration 10 ug/ml]
 - Validation comment
 - Immunofluorescence
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunoperoxidase of monoclonal antibody to TCEA1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
 - Protocol
 - Protocol