HPA000272

MSR1 antibody from Atlas Antibodies
CD204, SCARA1, SR-A, SR-AI, SR-AII, SR-AIII
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000272
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000272, RRID:AB_1846269
Product name
Anti-MSR1
Provider product page
Atlas Antibodies - HPA000272
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQ
EVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSM
TTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLI
SLNTTLLDLQLNIENL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -