HPA000272

MSR1 antibody from Sigma-Aldrich
CD204, SCARA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000272
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000272, RRID:AB_1846269
Product name
Anti-MSR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000272
Antibody type
Polyclonal
Antigen
Macrophage scavenger receptor types I and II recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQ
EVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSM
TTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLI
SLNTTLLDLQLNIENL
Storage
-20C
Provider Type Product Number
- No reagents -