HPA000685

FCN1 antibody from Sigma-Aldrich
FCNM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000685
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000685, RRID:AB_1078840
Product name
Anti-FCN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000685
Antibody type
Polyclonal
Antigen
Ficolin-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDK
LTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAP
GKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPR
NCKD
Storage
-20C
Provider Type Product Number
- No reagents -