HPA023043

MRPL12 antibody from MilliporeSigma / Merck KGaA
MRPL7, MRPL7/L12, RPML12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023043
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023043, RRID:AB_1854100
Product name
Anti-MRPL12 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023043
Antibody type
Polyclonal
Antigen
39S ribosomal protein L12, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCE
ALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISD
LNELLKKTLKIQDVGLVPMGG
Storage
-20C
Provider Type Product Number
- No reagents -