H00003315-M04
antibody from Abnova Corporation
Targeting: HSPB1
CMT2F, Hs.76067, Hsp25, HSP27, HSP28
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003315-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003315-M04, RRID:AB_714740
- Product name
- HSPB1 monoclonal antibody (M04), clone 3G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HSPB1.
- Antigen sequence
RVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDE
HGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTV
EAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSD
ETAAK- Isotype
- IgG
- Antibody clone number
- 3G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HSPB1 expression in transfected 293T cell line by HSPB1 monoclonal antibody (M04), clone 3G3.Lane 1: HSPB1 transfected lysate(22.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HSPB1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to HSPB1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of HSPB1 transfected lysate using anti-HSPB1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HSPB1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between AKT1 and HSPB1. Mahlavu cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-HSPB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)