Explore
Validate
LearnH00003315-D01P
antibody from Abnova Corporation
Targeting: HSPB1
CMT2F, Hs.76067, Hsp25, HSP27, HSP28
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Proximity ligation assay [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003315-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003315-D01P, RRID:AB_1576100
- Product name
- HSPB1 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human HSPB1 protein.
- Antigen sequence
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGL
PRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAA
PAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFA
PDELTVKTKDGVVEITGKHEERQDEHGYISRCFTR
KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQ
SNEITIPVTFESRAQLGGPEAAKSDETAAK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HSPB1 expression in transfected 293T cell line (H00003315-T01) by HSPB1 MaxPab polyclonal antibody.Lane 1: HSPB1 transfected lysate(22.80 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HSPB1 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPB1 expression in human liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between HSPB1 and F13A1. Huh7 cells were stained with anti-HSPB1 rabbit purified polyclonal 1:1200 and anti-F13A1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between HSPB1 and EGFR. HeLa cells were stained with anti-HSPB1 rabbit purified polyclonal 1:1200 and anti-EGFR mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
