HPA000497

HSPB1 antibody from Sigma-Aldrich
CMT2F, Hs.76067, Hsp25, HSP27, HSP28
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000497
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000497, RRID:AB_1851172
Product name
Anti-HSPB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000497
Antibody type
Polyclonal
Antigen
Heat shock protein beta-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYS
RALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDEL
TVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTL
PPGVDPTQVSS
Storage
-20C
Provider Type Product Number
- No reagents -