Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010403-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010403-M01, RRID:AB_464352
- Product name
- KNTC2 monoclonal antibody (M01), clone 1A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KNTC2.
- Antigen sequence
TVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVG
NNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEEC
MSEDLSENIKEIRDKYEKKATLIKSSEE- Isotype
- IgG
- Antibody clone number
- 1A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proinvasion metastasis drivers in early-stage melanoma are oncogenes.
Scott KL, Nogueira C, Heffernan TP, van Doorn R, Dhakal S, Hanna JA, Min C, Jaskelioff M, Xiao Y, Wu CJ, Cameron LA, Perry SR, Zeid R, Feinberg T, Kim M, Vande Woude G, Granter SR, Bosenberg M, Chu GC, DePinho RA, Rimm DL, Chin L
Cancer cell 2011 Jul 12;20(1):92-103
Cancer cell 2011 Jul 12;20(1):92-103
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- KNTC2 monoclonal antibody (M01), clone 1A10 Western Blot analysis of KNTC2 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged KNTC2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol