HPA000554

LGALS3BP antibody from Atlas Antibodies
90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000554
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000554, RRID:AB_1079246
Product name
Anti-LGALS3BP
Provider product page
Atlas Antibodies - HPA000554
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFD
SQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQ
ALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRID
ITLSSVKCFHKLAS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -