HPA000554

LGALS3BP antibody from Sigma-Aldrich
90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000554
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000554, RRID:AB_1079246
Product name
Anti-LGALS3BP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000554
Antibody type
Polyclonal
Antigen
Galectin-3-binding protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFD
SQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQ
ALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRID
ITLSSVKCFHKLAS
Storage
-20C
Provider Type Product Number
- No reagents -