HPA012065

TNK1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012065
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012065, RRID:AB_1858165
Product name
Anti-TNK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012065
Antibody type
Polyclonal
Antigen
Non-receptor tyrosine-protein kinase TNK1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSEACCVRDVTEPGALRMETGDPITVIEGSPDSTI
WKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHR
GTPARGDQHPGSIDGDRKKANLWDAPPARGQRRNM
PLERMKGISRSLESVLSLG
Storage
-20C
Provider Type Product Number
- No reagents -