HPA000499

GNPDA1 antibody from Sigma-Aldrich
GNPDA, GNPI, GPI, HLN, KIAA0060
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000499
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000499, RRID:AB_1079005
Product name
Anti-GNPDA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000499
Antibody type
Polyclonal
Antigen
Glucosamine-6-phosphate isomerase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPT
GSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVG
LPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNA
VDLQAECDAFEEKIKAA
Storage
-20C
Provider Type Product Number
- No reagents -