HPA042278

MGA antibody from Atlas Antibodies
FLJ12634, KIAA0518, MAD5, MXD5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA042278
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA042278, RRID:AB_10794647
Product name
Anti-MGA
Provider product page
Atlas Antibodies - HPA042278
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLGDVKVEQQKGFDNPEENSSEFPVTFKEESKFEL
SGSKVMEQQSNLQPEAKEKECGDSLEKDRERWRKH
LKGPLTRKCVGASQECKKEADEQLIKETKTCQENS
DVFQQEQGISDLLGKSGITEDARVLKTECDSWSRI
S
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -