R32278

MGA antibody from NSJ Bioreagents
FLJ12634, KIAA0518, MAD5, MXD5

Antibody data

Product number
R32278
Provider
NSJ Bioreagents
Product name
MGA Antibody
Provider product page
NSJ Bioreagents - R32278
Antibody type
Polyclonal
Antigen
Amino acids QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH of human MGA were used as the immunogen for the MGA antibody.
Description
Antigen affinity
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Vial size
100 µg
Concentration
Lyophilized; resuspend with 200 ul for 0.5 mg/ml
Storage
After reconstitution, the MGA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -