R32278
MGA antibody from NSJ Bioreagents
FLJ12634, KIAA0518, MAD5, MXD5
Antibody data
- Antibody Data
- Knockdown Reagents [0]
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R32278
- Provider
- NSJ Bioreagents
- Product name
- MGA Antibody
- Provider product page
- NSJ Bioreagents - R32278
- Antibody type
- Polyclonal
- Antigen
- Amino acids QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH of human MGA were used as the immunogen for the MGA antibody.
- Description
- Antigen affinity
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the MGA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
| Provider | Type | Product Number |
|---|---|---|
| - No reagents - | ||
