HPA058183

MGA antibody from Atlas Antibodies
FLJ12634, KIAA0518, MAD5, MXD5

Antibody data

Product number
HPA058183
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA058183, RRID:AB_2683632
Product name
Anti-MGA
Provider product page
Atlas Antibodies - HPA058183
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LGVQLPLAPATSFPFWNLTGTNPASPDAGFPFVSR
TGKTNDFTKIKGWRGKFHSASASRNEGGNSESSLK
NRSAFCSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -