PAB23917

MGA antibody from Abnova Corporation
FLJ12634, KIAA0518, MAD5, MXD5

Antibody data

Product number
PAB23917
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23917, RRID:AB_11132727
Product name
MGA polyclonal antibody
Provider product page
Abnova Corporation - PAB23917
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant MGA.
Antigen sequence
KLGDVKVEQQKGFDNPEENSSEFPVTFKEESKFEL
SGSKVMEQQSNLQPEAKEKECGDSLEKDRERWRKH
LKGPLTRKCVGASQECKKEADEQLIKETKTCQENS
DVFQQEQGISDLLGKSGITEDARVLKTECDSWSRI
S
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -