PA5-95338

MGA antibody from Invitrogen Antibodies
FLJ12634, KIAA0518, MAD5, MXD5

Antibody data

Product number
PA5-95338
Provider
Invitrogen Antibodies
Product name
Anti-MGA Polyclonal Antibody
Provider product page
Invitrogen Antibodies - PA5-95338
Antibody type
Polyclonal
Antigen
Synthetic peptide
Description
Synthetic peptide sequence: 2376-2415aa, QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH. Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Reactivity
Human
Host
Rabbit
Isotype
IgG
Vial size
100 µg
Concentration
500 µg/mL
Storage
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Provider Type Product Number
- No reagents -