Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001031 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001031, RRID:AB_1078610
- Product name
- Anti-CSTA
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYG
KLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFK
SLPGQNEDLV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma
From Gene Expression Analysis to Tissue Microarrays: A Rational Approach to Identify Therapeutic and Diagnostic Targets in Lymphoid Malignancies
Asplund A, Gry Björklund M, Sundquist C, Strömberg S, Edlund K, Östman A, Nilsson P, Pontén F, Lundeberg J
British Journal of Dermatology 2008 March;158(3):527-538
British Journal of Dermatology 2008 March;158(3):527-538
From Gene Expression Analysis to Tissue Microarrays: A Rational Approach to Identify Therapeutic and Diagnostic Targets in Lymphoid Malignancies
Ek S
Molecular & Cellular Proteomics 2006 March;5(6):1072-1081
Molecular & Cellular Proteomics 2006 March;5(6):1072-1081
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CSTA antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human esophagus tissue.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line hTCEpi shows localization to nucleus & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN