HPA001031

CSTA antibody from Sigma-Aldrich
STF1, STFA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001031
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001031, RRID:AB_1078610
Product name
Anti-CSTA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001031
Antibody type
Polyclonal
Antigen
Cystatin-A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYG
KLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFK
SLPGQNEDLV
Storage
-20C
Provider Type Product Number
- No reagents -