Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005552-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005552-M03, RRID:AB_1580149
- Product name
- SRGN monoclonal antibody (M03), clone 1D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant SRGN.
- Antigen sequence
MMQKLLKCSRLVLALALILVLESSVQGYPTQRARY
QWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRL
RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSG
SGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNL
PSDSQDLGQHGLEEDFML- Isotype
- IgG
- Antibody clone number
- 1D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Serglycin secretion is part of the inflammatory response in activated primary human endothelial cells in vitro.
Serglycin is a theranostic target in nasopharyngeal carcinoma that promotes metastasis.
Reine TM, Vuong TT, Jenssen TG, Kolset SO
Biochimica et biophysica acta 2014 Aug;1840(8):2498-505
Biochimica et biophysica acta 2014 Aug;1840(8):2498-505
Serglycin is a theranostic target in nasopharyngeal carcinoma that promotes metastasis.
Li XJ, Ong CK, Cao Y, Xiang YQ, Shao JY, Ooi A, Peng LX, Lu WH, Zhang Z, Petillo D, Qin L, Bao YN, Zheng FJ, Chia CS, Iyer NG, Kang TB, Zeng YX, Soo KC, Trent JM, Teh BT, Qian CN
Cancer research 2011 Apr 15;71(8):3162-72
Cancer research 2011 Apr 15;71(8):3162-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SRGN is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol