Antibody data

Product number
H00005552-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005552-M03, RRID:AB_1580149
Product name
SRGN monoclonal antibody (M03), clone 1D8
Provider product page
Abnova Corporation - H00005552-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SRGN.
Antigen sequence
MMQKLLKCSRLVLALALILVLESSVQGYPTQRARY
QWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRL
RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSG
SGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNL
PSDSQDLGQHGLEEDFML
Isotype
IgG
Antibody clone number
1D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -