Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000759 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000759, RRID:AB_1079675
- Product name
- Anti-SRGN
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MQKLLKCSRLVLALALILVLESSVQGYPTRRARYQ
WVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLR
TDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGS
GSGSGFLTEMEQDYQLVDE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Serglycin in Quiescent and Proliferating Primary Endothelial Cells.
Serglycin proteoglycan is required for multiple myeloma cell adhesion, in vivo growth, and vascularization.
Monocyte-to-Macrophage Differentiation
From Gene Expression Analysis to Tissue Microarrays: A Rational Approach to Identify Therapeutic and Diagnostic Targets in Lymphoid Malignancies
Reine TM, Vuong TT, Rutkovskiy A, Meen AJ, Vaage J, Jenssen TG, Kolset SO
PloS one 2015;10(12):e0145584
PloS one 2015;10(12):e0145584
Serglycin proteoglycan is required for multiple myeloma cell adhesion, in vivo growth, and vascularization.
Purushothaman A, Toole BP
The Journal of biological chemistry 2014 Feb 28;289(9):5499-509
The Journal of biological chemistry 2014 Feb 28;289(9):5499-509
Monocyte-to-Macrophage Differentiation
Chang M, Chan C, Braun K, Green P, O'Brien K, Chait A, Day A, Wight T
Journal of Biological Chemistry 2012 April;287(17):14122-14135
Journal of Biological Chemistry 2012 April;287(17):14122-14135
From Gene Expression Analysis to Tissue Microarrays: A Rational Approach to Identify Therapeutic and Diagnostic Targets in Lymphoid Malignancies
Ek S
Molecular & Cellular Proteomics 2006 March;5(6):1072-1081
Molecular & Cellular Proteomics 2006 March;5(6):1072-1081
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines A-549 and Caco-2 using Anti-SRGN antibody. Corresponding SRGN RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human bone marrow and liver tissues using Anti-SRGN antibody. Corresponding SRGN RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN