HPA000759

SRGN antibody from Sigma-Aldrich
PPG, PRG, PRG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000759
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000759, RRID:AB_1079675
Product name
Anti-SRGN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000759
Antibody type
Polyclonal
Antigen
Secretory granule proteoglycan core protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MQKLLKCSRLVLALALILVLESSVQGYPTRRARYQ
WVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLR
TDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGS
GSGSGFLTEMEQDYQLVDE
Storage
-20C
Provider Type Product Number
- No reagents -