HPA000399

TMX4 antibody from Sigma-Aldrich
DJ971N18.2, KIAA1162, PDIA14, TXNDC13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000399
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000399, RRID:AB_1858471
Product name
Anti-TMX4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000399
Antibody type
Polyclonal
Antigen
Thioredoxin domain-containing protein 13 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMT
ASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWEAFA
KNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFH
AKDGIF
Storage
-20C
Provider Type Product Number
- No reagents -