H00001060-B01

CENPC antibody from Abnova Corporation
CENP-C, CENPC1, hcp-4, MIF2

Antibody data

Product number
H00001060-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001060-B01, RRID:AB_1204137
Product name
CENPC1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00001060-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CENPC1 protein.
Antigen sequence
MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVL
EILQDCFEEKSLANDFSTNSTKSVPNSTRKIKDTC
IQSPSKECQKSHPKSVPVSSKKKEASLQFVVEPSE
ATNRSVQAHEVHQKILATDVSSKNTPDSKKISSRN
INDHHSEADEEFYLSVGSPSVLLDAKTSVSQNVIP
SSAQKRETYTFENSVNMLPSSTEVSVKTKKRLNFD
DKVMLKKIEIDNKVSDEEDKTSEGQERKPSGSSQN
RIRDSEYEIQRQAKKSFSTLFLETVKRKSESSPIV
RHAATAPPHSCPPDDTKLIEDEFIIDESDQSFASR
SWITIPRKAGSLKQRTISPAESTALLQGRKSREKH
HNILPKTLANDKHSHKPHPVETSQPSDKTVLDTSY
ALIGETVNNYRSTKYEMYSKNAEKPSRSKRTIKQK
QRRKFMAKPAEEQLDVGQSKDENIHTSHITQDEFQ
RNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRK
DKEESKKKRFSSESKNKLVPEEVTSTVTKSRRISR
RPSDWWVVKSEESCLKC
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -