HPA000980

AOC3 antibody from Sigma-Aldrich
HPAO, VAP-1, VAP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000980
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000980, RRID:AB_1078170
Product name
Anti-AOC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000980
Antibody type
Polyclonal
Antigen
Membrane copper amine oxidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DIDQMIFNRELPQASGLLHHCCFYKHRGRNLVTMT
TAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLEL
LVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFE
AGLVNVVLI
Storage
-20C
Provider Type Product Number
- No reagents -