Explore
Validate
LearnABIN633183
antibody from antibodies-online
Targeting: KHDRBS3
Etle, etoile, SALP, SLM-2, SLM2, T-STAR
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN633183 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-KH Domain Containing, RNA Binding, Signal Transduction Associated 3 (KHDRBS3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- KHDRBS3 antibody was raised using the C terminal of KHDRBS3 corresponding to a region with amino acids EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS
- Description
- Affinity purified
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
No comments: Submit comment
No validations: Submit validation data