HPA000500

KHDRBS3 antibody from Sigma-Aldrich
Etle, etoile, SALP, SLM-2, SLM2, T-STAR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000500
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000500, RRID:AB_1079184
Product name
Anti-KHDRBS3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000500
Antibody type
Polyclonal
Antigen
KH domain-containing, RNA-binding, signal transduction-associated protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GEGKDEEKYIDVVINKNMKLGQKVLIPVKQFPKFN
FVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDK
AKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAY
ARM
Storage
-20C
Provider Type Product Number
- No reagents -