HPA019777

DAZL antibody from MilliporeSigma / Merck KGaA
DAZH, DAZL1, DAZLA, MGC26406, SPGYLA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019777
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-DAZL antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019777
Antibody type
Polyclonal
Antigen
Deleted in azoospermia-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR
NSVVTQDDYFKDKRVHHFRRSRAMLK
Storage
-20C