HPA023649

SPEM2 antibody from Sigma-Aldrich
C17orf74
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023649
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023649, RRID:AB_1845606
Product name
Anti-C17orf74 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023649
Antibody type
Polyclonal
Antigen
Uncharacterized protein C17orf74 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPPPSLYLSPELRCMPKRVEARSELRLQSYGRHGS
QSRLWGNVEAEQWASSPPPPHRLPPNPSWVPVGHS
PYPSVGWMLYDSWDQ
Storage
-20C
Provider Type Product Number
- No reagents -