Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB19997 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB19997, RRID:AB_10961936
- Product name
- CKAP4 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant CKAP4.
- Antigen sequence
LKDLSDGIHVVKDARERDFTSLENTVEERLTELTK
SINDNIAIFTEVQKRSQKEINDMKAKVASLEESEG
NKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQT
MES- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: EFO-21, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with CKAP4 polyclonal antibody (Cat # PAB19997).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of cell lysates with CKAP4 polyclonal antibody (Cat # PAB19997).Lane 1 : NIH/3T3Lane 2 : NBT-IILane 3: PC-12
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex with CKAP4 polyclonal antibody (Cat # PAB19997) shows strong cytoplasmic positivity in neuronal cells at 1:500-1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)