HPA000792

CKAP4 antibody from Sigma-Aldrich
CLIMP-63, ERGIC-63, P63
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000792
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000792, RRID:AB_1078526
Product name
Anti-CKAP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000792
Antibody type
Polyclonal
Antigen
Cytoskeleton-associated protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKDLSDGIHVVKDARERDFTSLENTVEERLTELTK
SINDNIAIFTEVQKRSQKEINDMKAKVASLEESEG
NKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQT
MES
Storage
-20C
Provider Type Product Number
- No reagents -