Antibody data

Product number
ABIN1109105
Provider
antibodies-online
Product name
anti-SRY (Sex Determining Region Y)-Box 12 (SOX12) (C-Term) antibody
Provider product page
antibodies-online - ABIN1109105
Antibody type
Polyclonal
Antigen
The immunogen for anti-SOX12 antibody: synthetic peptide directed towards the C terminal of human SOX12.
Description
Purified using peptide immunoaffinity column
Reactivity
Human, Mouse, Rat, Canine
Host
Rabbit
Antigen sequence
DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIA
GDWRPSSIADLVFTY
Epitope
C-Term
Vial size
50 μg
Storage
Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Handling
Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -