Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109105 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-SRY (Sex Determining Region Y)-Box 12 (SOX12) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SOX12 antibody: synthetic peptide directed towards the C terminal of human SOX12.
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIA
GDWRPSSIADLVFTY- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Floppy SOX: mutual induced fit in hmg (high-mobility group) box-DNA recognition.
Weiss MA
Molecular endocrinology (Baltimore, Md.) 2001 Mar;15(3):353-62
Molecular endocrinology (Baltimore, Md.) 2001 Mar;15(3):353-62
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Jurkat; WB Suggested Anti-SOX12 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate; SOX12 antibody - C-terminal region (AP42200PU-N) in Human Jurkat cells using Western Blot