HPA024137

NCR3LG1 antibody from Atlas Antibodies
B7-H6, DKFZp686O24166
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024137
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024137, RRID:AB_1859534
Product name
Anti-NCR3LG1
Provider product page
Atlas Antibodies - HPA024137
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTF
DKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASL
RLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVAS
PASRLLLDQVGMKENEDKYMCESSGFY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -