Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001032 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001032, RRID:AB_1079586
- Product name
- Anti-PDCD4
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQF
IARAVGDGILCNTYIDSYKGTVDCVQARAALDKAT
VLLSMSKGGKRKDSVWGSGGGQQSVNHLVKE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references MicroRNA profiles in familial and sporadic medullary thyroid carcinoma: preliminary relationships with RET status and outcome.
Programmed cell death 4 nuclear loss and miR-21 or activated Akt overexpression in esophageal squamous cell carcinogenesis
PDCD4 nuclear loss inversely correlates with miR-21 levels in colon carcinogenesis
Programmed cell death 4 (PDCD4) expression during multistep Barrett's carcinogenesis.
MicroRNA expression profiling of human metastatic cancers identifies cancer gene targets
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
From Gene Expression Analysis to Tissue Microarrays: A Rational Approach to Identify Therapeutic and Diagnostic Targets in Lymphoid Malignancies
Mian C, Pennelli G, Fassan M, Balistreri M, Barollo S, Cavedon E, Galuppini F, Pizzi M, Vianello F, Pelizzo MR, Girelli ME, Rugge M, Opocher G
Thyroid : official journal of the American Thyroid Association 2012 Sep;22(9):890-6
Thyroid : official journal of the American Thyroid Association 2012 Sep;22(9):890-6
Programmed cell death 4 nuclear loss and miR-21 or activated Akt overexpression in esophageal squamous cell carcinogenesis
Fassan M, Realdon S, Pizzi M, Balistreri M, Battaglia G, Zaninotto G, Ancona E, Rugge M
Diseases of the Esophagus 2012 April;25(3):263-268
Diseases of the Esophagus 2012 April;25(3):263-268
PDCD4 nuclear loss inversely correlates with miR-21 levels in colon carcinogenesis
Fassan M, Pizzi M, Giacomelli L, Mescoli C, Ludwig K, Pucciarelli S, Rugge M
Virchows Archiv 2011 April;458(4):413-419
Virchows Archiv 2011 April;458(4):413-419
Programmed cell death 4 (PDCD4) expression during multistep Barrett's carcinogenesis.
Fassan M, Pizzi M, Battaglia G, Giacomelli L, Parente P, Bocus P, Ancona E, Rugge M
Journal of clinical pathology 2010 Aug;63(8):692-6
Journal of clinical pathology 2010 Aug;63(8):692-6
MicroRNA expression profiling of human metastatic cancers identifies cancer gene targets
Baffa R, Fassan M, Volinia S, O'Hara B, Liu C, Palazzo J, Gardiman M, Rugge M, Gomella L, Croce C, Rosenberg A
The Journal of Pathology 2009 October;219(2):214-221
The Journal of Pathology 2009 October;219(2):214-221
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
From Gene Expression Analysis to Tissue Microarrays: A Rational Approach to Identify Therapeutic and Diagnostic Targets in Lymphoid Malignancies
Ek S
Molecular & Cellular Proteomics 2006 March;5(6):1072-1081
Molecular & Cellular Proteomics 2006 March;5(6):1072-1081
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human breast and skeletal muscle tissues using HPA001032 antibody. Corresponding PDCD4 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human thyroid gland shows strong nuclear positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human thyroid gland shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong nuclear positivity in epidermal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN