HPA001032

PDCD4 antibody from Sigma-Aldrich
H731
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001032
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001032, RRID:AB_1079586
Product name
Anti-PDCD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001032
Antibody type
Polyclonal
Antigen
Programmed cell death protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQF
IARAVGDGILCNTYIDSYKGTVDCVQARAALDKAT
VLLSMSKGGKRKDSVWGSGGGQQSVNHLVKE
Storage
-20C
Provider Type Product Number
- No reagents -