HPA024185

RBCK1 antibody from Atlas Antibodies
C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP4, ZRANB4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024185
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024185, RRID:AB_1845673
Product name
Anti-RBCK1
Provider product page
Atlas Antibodies - HPA024185
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGF
PPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLY
LLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQP
RGPLEPGPPKPGVPQEPGRGQPDAVPEP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -