H00010616-M01
antibody from Abnova Corporation
Targeting: RBCK1
C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP4, ZRANB4
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010616-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010616-M01, RRID:AB_581820
- Product name
- C20orf18 monoclonal antibody (M01), clone 3C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant C20orf18.
- Antigen sequence
TATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDM
TVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETL
HSHGVRQNGDSAYLYLLSARNTSLNPQ- Isotype
- IgG
- Antibody clone number
- 3C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of C20orf18 expression in transfected 293T cell line by C20orf18 monoclonal antibody (M01), clone 3C3.Lane 1: C20orf18 transfected lysate(25.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged C20orf18 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RBCK1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol