AMAb91288
antibody from Atlas Antibodies
Targeting: RBCK1
C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP4, ZRANB4
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91288 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91288, RRID:AB_2665882
- Product name
- Anti-RBCK1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGF
PPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLY
LLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQP
RGPLEPGPPKPGVPQEPGRGQPDAVPEP- Epitope
- Binds to an epitope located within the peptide sequence KDMVFLDYGFPPVLQ as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL4289
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line HepG2.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong cytoplasmic immunoreactivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows cytoplasmic positivity in seminiferous tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows cytoplasmic immunoreactivity in hepatocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity mainly in renal tubules.