Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000556 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000556, RRID:AB_1078567
- Product name
- Anti-CRIM1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNI
INGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEE
KPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCP
LP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references SOST Inhibits Prostate Cancer Invasion.
Production of a mouse line with a conditional Crim1 mutant allele.
CRIM1 is localized to the podocyte filtration slit diaphragm of the adult human kidney.
From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies.
Hudson BD, Hum NR, Thomas CB, Kohlgruber A, Sebastian A, Collette NM, Coleman MA, Christiansen BA, Loots GG
PloS one 2015;10(11):e0142058
PloS one 2015;10(11):e0142058
Production of a mouse line with a conditional Crim1 mutant allele.
Chiu HS, York JP, Wilkinson L, Zhang P, Little MH, Pennisi DJ
Genesis (New York, N.Y. : 2000) 2012 Sep;50(9):711-6
Genesis (New York, N.Y. : 2000) 2012 Sep;50(9):711-6
CRIM1 is localized to the podocyte filtration slit diaphragm of the adult human kidney.
Nyström J, Hultenby K, Ek S, Sjölund J, Axelson H, Jirström K, Saleem MA, Nilsson K, Johansson ME
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2009 Jul;24(7):2038-44
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2009 Jul;24(7):2038-44
From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies.
Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck CA
Molecular & cellular proteomics : MCP 2006 Jun;5(6):1072-81
Molecular & cellular proteomics : MCP 2006 Jun;5(6):1072-81
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and liver tissues using Anti-CRIM1 antibody. Corresponding CRIM1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN
