HPA000556

CRIM1 antibody from Atlas Antibodies
S52
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000556
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000556, RRID:AB_1078567
Product name
Anti-CRIM1
Provider product page
Atlas Antibodies - HPA000556
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNI
INGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEE
KPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCP
LP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -