HPA000556

CRIM1 antibody from Sigma-Aldrich
S52
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000556
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000556, RRID:AB_1078567
Product name
Anti-CRIM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000556
Antibody type
Polyclonal
Antigen
Cysteine-rich motor neuron 1 protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNI
INGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEE
KPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCP
LP
Storage
-20C
Provider Type Product Number
- No reagents -