Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000555 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-DLG5
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QQCDTITILAQYNPHVHQLSSHSRSSSHLDPAGTH
STLQGSGTTTPEHPSVIDPLMEQDEGPSTPPAKQS
SSRIAGDANKKTLEPRVVFIKKSQLELGVHLCGGN
LHG- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references From Gene Expression Analysis to Tissue Microarrays
Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck C
Molecular & Cellular Proteomics 2006;5(6):1072-1081
Molecular & Cellular Proteomics 2006;5(6):1072-1081
No comments: Submit comment
No validations: Submit validation data