HPA000555

DLG5 antibody from Sigma-Aldrich
KIAA0583, P-dlg
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000555
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000555, RRID:AB_1847728
Product name
Anti-DLG5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000555
Antibody type
Polyclonal
Antigen
Disks large homolog 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQCDTITILAQYNPHVHQLSSHSRSSSHLDPAGTH
STLQGSGTTTPEHPSVIDPLMEQDEGPSTPPAKQS
SSRIAGDANKKTLEPRVVFIKKSQLELGVHLCGGN
LHG
Storage
-20C
Provider Type Product Number
- No reagents -