HPA022961

C17orf49 antibody from Atlas Antibodies
BAP18, HEPIS, MGC49942
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022961
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022961, RRID:AB_1845592
Product name
Anti-C17orf49
Provider product page
Atlas Antibodies - HPA022961
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSS
PAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKER
TVAQIKATVKRKVYEDSGI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -