H00124944-B01

C17orf49 antibody from Abnova Corporation
BAP18, HEPIS, MGC49942

Antibody data

Product number
H00124944-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00124944-B01, RRID:AB_1137840
Product name
C17orf49 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00124944-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C17orf49 protein.
Antigen sequence
MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADS
SPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKE
RTVAQIKATVKRKVYEDSGIPLPAESPKKGPKKVA
SGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTL
SALNDSDANSDVVDIEGLGETPPAKKLNFDQA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -