H00010160-B01P

FARP1 antibody from Abnova Corporation
CDEP, MGC87400, PLEKHC2, PPP1R75

Antibody data

Product number
H00010160-B01P
Provider
Abnova Corporation
Product name
FARP1 purified MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00010160-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human FARP1 protein.
Antigen sequence
MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTP
SGKLVSIKIQMLDDTQEAFEVPMVSSSSFLKAIGS
SWTGWVLRCSMKPKHHSHLIEKFGEDRILTHLTGS
ISYTNWAGSRSLAVTVTEELLNLF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -