HPA000760

FARP1 antibody from Sigma-Aldrich
CDEP, MGC87400, PLEKHC2, PPP1R75
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000760
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000760, RRID:AB_1078816
Product name
Anti-FARP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000760
Antibody type
Polyclonal
Antigen
FERM, RhoGEF and pleckstrin domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSI
IVAASSRSEMEKWVEDIQMAIDLAEKSSSPAPEFL
ASSPPDNKSPDEATAADQESEDDLSASRTSLERQA
PHRGNTMV
Storage
-20C
Provider Type Product Number
- No reagents -